Anti-CANX
Overview
The Anti-CANX antibody (HPA009696) is a rabbit Triple A Polyclonal reagent targeting human calnexin, an endoplasmic reticulum–resident chaperone involved in glycoprotein folding and quality control. The antibody is generated against a recombinant fragment enriched in acidic, regulatory, and basic residues. Validated exclusively for immunohistochemistry, it supports localisation of calnexin in fixed tissues.
Highlights
- Rabbit Triple A Polyclonal antibody identifying human calnexin
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment corresponding to regulatory C-terminal region
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- CANX (calnexin)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- TSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRR
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody facilitates immunohistochemical localisation of calnexin, supporting studies of ER function, protein folding quality control, and cellular stress responses in human tissues.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
