Anti-GUCY2C Antibody
Overview
This antibody is raised against a protein sequence from human GUCY2C (guanylate cyclase 2C), also known as the heat-stable enterotoxin receptor. It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GUCY2C in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human GUCY2C
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined GUCY2C protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- GUCY2C (guanylate cyclase 2C)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of GUCY2C in human tissue sections. It may be used in research examining epithelial marker expression and receptor localisation. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
