Anti-APOL2
Overview
The Anti-APOL2 antibody (HPA001078) is a rabbit Triple A Polyclonal reagent targeting human APOL2, a member of the apolipoprotein L family implicated in lipid transport and cellular stress responses. The antibody is generated using a recombinant APOL2 protein fragment corresponding to a defined antigenic region, enabling sequence-specific immunodetection. Validated exclusively for Western blot analysis, it is suited for detecting APOL2 expression in human-derived protein samples.
Highlights
- Rabbit Triple A Polyclonal antibody against human APOL2
- Validated only for Western blot (WB) applications
- Recombinant antigen fragment defining target specificity
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- APOL2 (apolipoprotein L, 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- LGVRVREEEAGTRVKENLPVWTVTGELQGKPLGNPAAGTMNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHR
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of APOL2 in human protein extracts, enabling studies of lipid-associated pathways, cellular stress responses, and apolipoprotein family function. It is suitable for assessing APOL2 expression in both physiological and disease-related research contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
