Anti-AQP4
Overview
The Anti-AQP4 antibody (HPA014784) is a rabbit Triple A Polyclonal reagent directed against human aquaporin 4 (AQP4), a membrane water channel highly expressed in astrocytes and involved in fluid homeostasis in the central nervous system. The antibody is produced using a recombinant AQP4 protein fragment corresponding to a defined antigenic region. Validated exclusively for immunohistochemistry, it is suited for detecting AQP4 distribution in fixed human tissue sections.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human AQP4
- Validated only for immunohistochemistry (IHC)
- Generated using a defined recombinant AQP4 antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- AQP4 (aquaporin 4)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical localisation of AQP4 in human tissues, aiding investigations into water transport, astrocytic physiology, and central nervous system homeostasis. It is suitable for examining AQP4 expression patterns in both normal and pathological contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
