Anti-AQP5
Overview
The Anti-AQP5 antibody (HPA065008) is a rabbit Triple A Polyclonal reagent directed against human aquaporin 5 (AQP5), a membrane water channel involved in fluid secretion in salivary, lacrimal, and pulmonary epithelia. The antibody is produced using a recombinant AQP5 protein fragment corresponding to a defined antigenic region. Validated exclusively for immunohistochemistry, it supports localisation studies of AQP5 expression in fixed human tissues.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human AQP5
- Validated only for immunohistochemistry (IHC)
- Generated using a defined recombinant AQP5 antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- AQP5 (aquaporin 5)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables immunohistochemical detection of AQP5 in human tissues, supporting research on epithelial fluid secretion, glandular physiology, and membrane transport mechanisms. It is suitable for assessing AQP5 distribution in both normal and pathological conditions.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
