Anti-ARHGEF1
Overview
The Anti-ARHGEF1 antibody (HPA012924) is a rabbit Triple A Polyclonal reagent targeting human ARHGEF1, a Rho guanine nucleotide exchange factor involved in regulating cytoskeletal organisation and signal transduction. The antibody is produced using a recombinant ARHGEF1 protein fragment corresponding to a defined antigenic region, enabling sequence-specific immunodetection. It is validated exclusively for Western blot applications and supplied in a stabilising aqueous buffer.
Highlights
- Rabbit Triple A Polyclonal antibody against human ARHGEF1
- Validated only for Western blot (WB)
- Generated using a defined recombinant ARHGEF1 antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ARHGEF1 (Rho guanine nucleotide exchange factor 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREP
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of ARHGEF1 in human protein samples, aiding studies of cytoskeletal regulation, Rho GTPase signalling, and cellular response pathways. It is suitable for examining ARHGEF1 expression in physiological and disease-related research contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
