Anti-ARNT2
Overview
The Anti-ARNT2 antibody (HPA001056) is a rabbit Triple A Polyclonal reagent targeting human ARNT2, a transcription factor of the bHLH-PAS family involved in developmental and neuronal regulatory pathways. The antibody is produced using a recombinant ARNT2 protein fragment corresponding to a defined antigenic region, enabling sequence-specific recognition. Validated exclusively for immunocytochemistry, it is suitable for detecting ARNT2 expression in fixed cultured human cells.
Highlights
- Rabbit Triple A Polyclonal antibody against human ARNT2
- Validated only for immunocytochemistry (ICC)
- Generated using a defined recombinant ARNT2 antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ARNT2 (aryl-hydrocarbon receptor nuclear translocator 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Immunocytochemistry (ICC) only
- Immunogen sequence
- GKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFS
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunocytochemical detection of ARNT2 in cultured human cells, aiding studies of transcriptional regulation, neuronal development, and bHLH-PAS signalling pathways. It is well suited for mapping ARNT2 localisation in cellular models of physiological and disease-related processes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
