Anti-ASGR1
Overview
The Anti-ASGR1 antibody) is a rabbit Triple A Polyclonal reagent directed against human asialoglycoprotein receptor 1 (ASGR1), a C-type lectin receptor predominantly expressed in hepatocytes and involved in endocytosis of desialylated glycoproteins. Antibodies in this set are generated using recombinant ASGR1 protein fragments corresponding to defined extracellular and N-terminal sequence regions, enabling sequence-specific immunodetection. The range includes formats validated for Western blot and immunohistochemistry, supporting analysis of ASGR1 expression in lysates and tissue sections.
Highlights
- Rabbit Triple A Polyclonal antibodies targeting human ASGR1
- Formats validated for Western blot (WB) and immunohistochemistry (IHC)
- Recombinant ASGR1 antigen fragments define the targeted epitopes
- Supplied in a glycerol-containing PBS buffer with preservative
At-a-glance
- Antigen
- ASGR1 (asialoglycoprotein receptor 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validated applications
- Western blot (WB); immunohistochemistry (IHC) — format dependent
- Representative immunogen sequence (N-terminal)
- MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRL
- Representative immunogen sequence (extracellular domain)
- RETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWE
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
These antibodies support detection of ASGR1 in human samples for studies of hepatocyte-specific endocytosis, liver receptor biology, and glycoprotein clearance pathways. Western blot formats enable analysis of ASGR1 expression and molecular weight in lysates, while IHC-validated formats are suited to mapping receptor distribution in liver and other tissues under physiological or disease-associated conditions.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
