Anti-ASPA
Overview
The Anti-ASPA antibody (HPA022142) is a rabbit Triple A Polyclonal reagent targeting human aspartoacylase (ASPA), an enzyme involved in N-acetylaspartate metabolism within the central nervous system. The antibody is raised against a recombinant protein fragment corresponding to a defined ASPA sequence region. Validated exclusively for immunohistochemistry, it is suitable for detecting ASPA expression in fixed human tissues.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human ASPA
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment defining target specificity
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- ASPA (aspartoacylase)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAK
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical localisation of ASPA in human tissues, aiding studies of neuronal metabolism, myelin-associated pathways, and enzymatic function in the central nervous system. It is suitable for examining ASPA distribution under physiological and pathological conditions.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
