Anti-ATN1
Overview
The Anti-ATN1 antibody (HPA031619) is a rabbit Triple A Polyclonal reagent targeting human atrophin 1 (ATN1), a transcriptional corepressor associated with neuronal development and regulatory signalling pathways. The antibody is raised against a recombinant ATN1 protein fragment corresponding to a defined low-complexity sequence region enriched in serine and proline residues. Validated exclusively for immunohistochemistry, it supports localisation of ATN1 in fixed human tissue sections.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human ATN1
- Validated only for immunohistochemistry (IHC)
- Recombinant ATN1 antigen fragment defining target specificity
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ATN1 (atrophin 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- HPYAMSPSLGSLRPYPPGPAHLPPPHSQVSYSQAGPNGPPVSSSSNSSSSTSQGSYPCSHPSPSQGPQGAPYPFPPVPTVTTSSATLSTVIATVASSPAGYKTASPPGPPPYGKRAPSPGAYKTATPPGYKPGSPPSFRTGTPPGY
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody facilitates immunohistochemical detection of ATN1 in human tissues, enabling studies of transcriptional repression mechanisms, neuronal differentiation, and signalling pathways involving atrophin family proteins. It is suited for mapping ATN1 expression in both normal and pathological samples.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
