Anti-ATP6AP2
Overview
The Anti-ATP6AP2 antibody (HPA003156 series) is a rabbit Triple A Polyclonal reagent recognising human ATP6AP2, an accessory protein associated with vacuolar H+-ATPase function and implicated in pH regulation and receptor-associated signalling. The antibodies within this series are generated using a recombinant ATP6AP2 protein fragment corresponding to a defined antigenic region. Formats validated for Western blot and immunohistochemistry are available, supporting both protein-level and tissue-level analysis of ATP6AP2 expression.
Highlights
- Rabbit Triple A Polyclonal antibodies targeting human ATP6AP2
- Validated formats available for Western blot (WB) and immunohistochemistry (IHC)
- Recombinant antigen fragment defining the recognised epitope
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- ATP6AP2 (ATPase H+-transporting lysosomal accessory protein 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated applications
- Western blot (WB); immunohistochemistry (IHC)
- Immunogen sequence
- NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
These antibodies support detection of ATP6AP2 in human protein preparations by Western blot, enabling studies of vacuolar ATPase-associated processes and proton transport mechanisms. IHC-validated formats facilitate localisation of ATP6AP2 within fixed tissues, supporting investigations into its roles in cellular signalling, membrane dynamics, and lysosomal function across physiological and pathological contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
