Anti-ATRX
Overview
The Anti-ATRX antibody (HPA001906 series) is a rabbit Triple A Polyclonal reagent targeting human ATRX, a chromatin remodelling protein implicated in transcriptional regulation, heterochromatin maintenance, and genome stability. These antibodies are generated using a recombinant ATRX protein fragment corresponding to a defined sequence region within the N-terminal portion of the protein. Formats within this series are validated for Western blot and immunocytochemistry, supporting studies of ATRX expression in protein extracts and cultured human cells.
Highlights
- Rabbit Triple A Polyclonal antibodies targeting human ATRX
- Validated formats for Western blot (WB) and immunocytochemistry (ICC)
- Recombinant ATRX antigen fragment defining epitope specificity
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- ATRX (alpha thalassaemia/mental retardation syndrome X-linked)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated applications
- Western blot (WB); immunocytochemistry (ICC)
- Immunogen sequence
- AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
These antibodies support Western blot detection of ATRX in human protein extracts, enabling investigation of chromatin remodelling processes, DNA repair mechanisms, and transcriptional regulation. ICC-validated formats allow localisation of ATRX within cultured cells, aiding studies of nuclear architecture, heterochromatin-associated functions, and ATRX-related cellular phenotypes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
