Anti-AURKA
Overview
The Anti-AURKA antibody (HPA002636) is a rabbit Triple A Polyclonal reagent targeting human aurora kinase A (AURKA), a serine/threonine kinase essential for mitotic progression, centrosome maturation, and spindle assembly. The antibody is raised against a recombinant AURKA protein fragment corresponding to a defined N-terminal sequence region containing regulatory and low-complexity motifs. Validated exclusively for Western blot applications, it enables detection of AURKA in human protein extracts.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human AURKA
- Validated only for Western blot (WB)
- Recombinant antigen fragment defining the antibody epitope
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- AURKA (aurora kinase A)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables Western blot detection of AURKA in human cell and tissue lysates, supporting studies of mitotic regulation, centrosome biology, and kinase-dependent cell cycle pathways. It is suitable for research into proliferation dynamics and AURKA-associated regulatory mechanisms in both normal and transformed cellular contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
