Anti-B4GALNT2
Overview
The Anti-B4GALNT2 antibody (HPA015721) is a rabbit Triple A Polyclonal reagent targeting human beta-1,4-N-acetyl-galactosaminyltransferase 2 (B4GALNT2), an enzyme involved in glycosylation pathways and the biosynthesis of terminal carbohydrate structures. The antibody is produced using a recombinant B4GALNT2 protein fragment corresponding to a defined antigenic region. Validated exclusively for Western blot applications, it supports the detection of B4GALNT2 in human protein preparations.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human B4GALNT2
- Validated only for Western blot (WB)
- Recombinant antigen fragment defining sequence specificity
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- B4GALNT2 (beta-1,4-N-acetyl-galactosaminyl transferase 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of B4GALNT2 in human lysates, enabling studies of glycosyltransferase function, carbohydrate biosynthesis pathways, and differential glycosylation across tissues or experimental conditions. It is suitable for research into both fundamental glyco-biology and disease-associated glycan modulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
