Anti-BASP1
Overview
The Anti-BASP1 antibody (HPA045218) is a rabbit Triple A Polyclonal reagent directed against human BASP1, a myristoylated membrane-associated protein implicated in neuronal differentiation, cytoskeletal regulation, and transcriptional control. The antibody is raised against a recombinant N-terminal BASP1 fragment that includes lysine-rich regulatory motifs. Validated exclusively for Western blot applications, it enables detection of BASP1 in human protein extracts.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human BASP1
- Validated only for Western blot (WB)
- Recombinant antigen fragment representing BASP1 N-terminal regulatory region
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- BASP1 (brain abundant, membrane attached signal protein 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of BASP1 in human samples, enabling studies of neuronal signalling pathways, membrane-associated protein complexes, and transcriptional regulation mediated by BASP1. It is suitable for assessing BASP1 expression across a variety of cellular and developmental research contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
