Anti-BCAR1
Overview
The Anti-BCAR1 antibody (HPA042282 series) is a rabbit Triple A Polyclonal reagent directed against human BCAR1, an adaptor protein that integrates cytoskeletal organisation, cell adhesion dynamics, and signal transduction pathways. These antibodies are generated using a recombinant BCAR1 fragment rich in proline-serine–threonine motifs characteristic of scaffold protein interaction regions. Formats validated for Western blot and immunohistochemistry are available, enabling detection of BCAR1 both in protein lysates and fixed human tissues.
Highlights
- Rabbit Triple A Polyclonal antibodies targeting human BCAR1
- Validated formats for Western blot (WB) and immunohistochemistry (IHC)
- Recombinant antigen fragment enriched in signalling and scaffold-associated motifs
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- BCAR1 (breast cancer anti-estrogen resistance 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated applications
- Western blot (WB); immunohistochemistry (IHC)
- Immunogen sequence
- SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYD
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
These antibodies support detection of BCAR1 in human samples, facilitating studies of focal adhesion signalling, cytoskeletal rearrangement, and cell migration pathways. Western blot formats enable protein-level expression analysis, while IHC-validated formats permit localisation of BCAR1 in tissue environments relevant to developmental, physiological, and disease-related processes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
