Anti-BGN
Overview
This Anti-BGN antibody entry provides a combined description for the HPA003157 series, comprising rabbit Triple A Polyclonal antibodies targeting human biglycan (BGN), a small leucine-rich proteoglycan involved in extracellular matrix assembly, collagen organisation, and cell signalling. These antibodies are generated using a single recombinant antigen fragment corresponding to a defined region of the BGN core protein. Formats validated for Western blot and immunohistochemistry are available, enabling both protein-level and tissue-level detection of BGN.
Highlights
- Rabbit Triple A Polyclonal antibodies recognising human biglycan (BGN)
- Validated formats for Western blot (WB) and immunohistochemistry (IHC)
- Recombinant antigen fragment derived from the BGN core protein
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- BGN (biglycan)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated applications
- Western blot (WB); immunohistochemistry (IHC)
- Immunogen sequence
- RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
These antibodies support detection of biglycan in human samples, enabling studies of extracellular matrix biology, fibrosis, tissue integrity, and proteoglycan-mediated signalling. Western blot formats allow quantitative analysis of BGN expression, while IHC-validated formats permit spatial localisation of biglycan within tissue sections under physiological and pathological conditions.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
