Anti-BICD1
Overview
The Anti-BICD1 antibody (HPA041309) is a rabbit Triple A Polyclonal reagent targeting human BICD1, a dynein–cargo adaptor protein involved in intracellular transport and vesicle trafficking. The antibody is produced using a recombinant BICD1 fragment corresponding to a low-complexity, regulatory region of the protein. Validated exclusively for Western blot applications, it supports the detection of BICD1 in human protein lysates.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human BICD1
- Validated only for Western blot (WB)
- Recombinant antigen fragment defining epitope specificity
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- BICD1 (bicaudal D homolog 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody is suitable for Western blot detection of BICD1 in human protein extracts, supporting studies of cargo transport mechanisms, microtubule-associated trafficking, and adaptor protein functions in neuronal and non-neuronal systems.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
