Anti-BICD2
Overview
The Anti-BICD2 antibody (HPA023013) is a rabbit Triple A Polyclonal reagent targeting human BICD2, a dynein-activating adaptor protein involved in microtubule-based cargo transport and neuronal development. The antibody is generated using a recombinant BICD2 fragment corresponding to a defined α-helical region of the protein. Validated exclusively for immunohistochemistry, it supports localisation of BICD2 in fixed human tissues.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human BICD2
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment representing a structured BICD2 region
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- BICD2 (bicaudal D homolog 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Immunohistochemistry (IHC) only
- Immunogen sequence
- MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAI
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical localisation of BICD2 in human tissues, enabling studies of dynein-mediated cargo movement, neuronal polarity, and intracellular transport pathways relevant to development and disease.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
