Anti-BMT2
Overview
The Anti-BMT2 antibody (HPA050733) is a rabbit Triple A Polyclonal reagent targeting human BMT2, a predicted base methyltransferase homolog implicated in rRNA modification and ribonucleoprotein complex function. The antibody is produced using a recombinant fragment encompassing a structured region containing cysteine-rich and basic motifs associated with nucleic acid interaction. Validated exclusively for immunocytochemistry, it enables localisation of BMT2 in fixed human cell preparations.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human BMT2
- Validated only for immunocytochemistry (ICC)
- Recombinant antigen fragment representing a cysteine-rich structured region
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- BMT2 (base methyltransferase of 25S rRNA 2 homolog)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Immunocytochemistry (ICC) only
- Immunogen sequence
- QERKLEQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHCEDEETLCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREYFQ
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunocytochemical detection of BMT2 in fixed human cells, aiding studies of rRNA modification enzymes, nucleolar processes, and ribonucleoprotein complex biogenesis. It is suitable for investigating BMT2 expression and localisation in diverse cellular models.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
