Anti-BRWD1
Overview
The Anti-BRWD1 antibody (HPA030945) is a rabbit Triple A Polyclonal reagent targeting human BRWD1, a protein characterised by bromodomains and WD repeats and implicated in chromatin-associated regulation and transcriptional control. The antibody is raised against a recombinant sequence fragment enriched in basic and regulatory motifs typical of chromatin-interacting proteins. Validated exclusively for immunohistochemistry, it supports localisation of BRWD1 within fixed human tissues.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human BRWD1
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment representing regulatory BRWD1 regions
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- BRWD1 (bromodomain and WD repeat domain containing 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Immunohistochemistry (IHC) only
- Immunogen sequence
- RTRAAQRKTGPVSLANGCGRKATRKRVYLSDSDNNSLETGEILKARAGNNRKVLRKCAAVAANKIKLMSDVEENSSSESVCSGRKLPHRNASAVA
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical detection of BRWD1 in human tissue, facilitating studies of chromatin-associated regulatory mechanisms, transcriptional modulation, and protein complexes involving WD repeat and bromodomain-containing factors. It is suitable for examining BRWD1 localisation in developmental and disease-related contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
