Anti-BSND
Overview
The Anti-BSND antibody (HPA053836) is a rabbit Triple A Polyclonal reagent targeting human BSND, an accessory β-subunit of CLCNK-type chloride channels required for proper channel trafficking and function in epithelial tissues. The antibody is raised against a recombinant BSND fragment containing structured and low-complexity sequence motifs. Validated exclusively for immunohistochemistry, it supports localisation of BSND in fixed human tissue samples.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human BSND
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment representing regulatory and structured BSND regions
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- BSND (barttin, CLCNK-type chloride channel accessory β-subunit)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Immunohistochemistry (IHC) only
- Immunogen sequence
- SPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDL
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical localisation of BSND in human tissues, aiding studies of epithelial ion transport, chloride channel regulation, and protein complexes associated with renal and inner ear physiology. It is suitable for examining BSND distribution across diverse tissue contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
