Anti-BTK
Overview
This Anti-BTK antibody entry provides a combined description for the HPA001198 and HPA002028 series, consisting of rabbit Triple A Polyclonal antibodies directed against human Bruton agammaglobulinemia tyrosine kinase (BTK). BTK is a non-receptor tyrosine kinase essential for B-cell receptor signalling, intracellular phosphorylation networks, and immune cell development. The antibodies are raised against two distinct recombinant BTK fragments representing functional and regulatory regions of the protein. Formats validated for Western blot and immunohistochemistry are available, supporting both protein-level and tissue-level detection of BTK.
Highlights
- Rabbit Triple A Polyclonal antibodies targeting human BTK
- Validated formats for Western blot (WB) and immunohistochemistry (IHC)
- Distinct recombinant antigen fragments covering different BTK domains
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- BTK (Bruton agammaglobulinemia tyrosine kinase)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated applications
- Western blot (WB); immunohistochemistry (IHC)
- Immunogen sequence (HPA001198)
- PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL
- Immunogen sequence (HPA002028)
- CVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQIL
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
These antibodies enable the detection of BTK across human research samples. Western blot formats support analysis of BTK expression and molecular weight in lysates, while IHC-validated formats provide spatial localisation in fixed tissues. Together, they aid studies of B-cell receptor signalling, kinase regulation, and immune-related pathways under physiological and experimental conditions.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
