Anti-BTN3A1
Overview
The Anti-BTN3A1 antibody (HPA012565) is a rabbit Triple A Polyclonal reagent targeting human BTN3A1, a butyrophilin family member involved in immune cell regulation and antigen presentation–related processes. The antibody is raised against a recombinant BTN3A1 fragment corresponding to a defined extracellular sequence region. Validated exclusively for immunohistochemistry, it enables localisation of BTN3A1 within fixed human tissues.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human BTN3A1
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment representing BTN3A1 extracellular domain
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- BTN3A1 (butyrophilin, subfamily 3, member A1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Immunohistochemistry (IHC) only
- Immunogen sequence
- KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical detection of BTN3A1 in human tissues, aiding investigations into butyrophilin-mediated immune regulation, cell signalling processes, and tissue-specific expression patterns relevant to immunology and disease research.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
