Anti-C11orf84
Overview
The Anti-C11orf84 antibody (HPA040128) is a rabbit Triple A Polyclonal reagent targeting human C11orf84, a protein of currently uncharacterised function encoded on chromosome 11. The antibody is raised against a recombinant fragment containing acidic, proline-rich, and cysteine-rich motifs characteristic of regulatory low-complexity regions. Validated exclusively for Western blot applications, it enables detection of C11orf84 in human lysates.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human C11orf84
- Validated only for Western blot (WB)
- Recombinant antigen fragment enriched in regulatory sequence motifs
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- C11orf84 (chromosome 11 open reading frame 84)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- DCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRALCMVCGAEIRAPS
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of C11orf84, providing a tool for exploratory analysis of its expression patterns and potential involvement in human cellular processes. It is suitable for characterising protein abundance and assessing comparative expression across experimental models.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
