Anti-C17orf62
Overview
The Anti-C17orf62 antibody (HPA045696) is a rabbit Triple A Polyclonal reagent directed against human chromosome 17 open reading frame 62 (C17orf62), a protein of currently uncharacterised function. The antibody is raised against a recombinant fragment corresponding to an N-terminal region containing mixed helical and low-complexity motifs. Validated exclusively for immunohistochemistry, it allows localisation of C17orf62 in fixed human tissues.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human C17orf62
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment representing N-terminal sequence region
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- C17orf62 (chromosome 17 open reading frame 62)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical detection of C17orf62, aiding exploratory studies of protein distribution and expression patterns across human tissues. It is suitable for profiling this uncharacterised protein in physiological and experimental contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
