Anti-C19orf47
Overview
The Anti-C19orf47 antibody (HPA046309) is a rabbit Triple A Polyclonal reagent targeting human chromosome 19 open reading frame 47 (C19orf47), a protein with limited functional annotation. The antibody is produced using a recombinant antigen fragment enriched in serine-rich and regulatory motifs. Validated exclusively for immunohistochemistry, it supports localisation of C19orf47 in fixed human tissues.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human C19orf47
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment representing serine-rich region
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- C19orf47 (chromosome 19 open reading frame 47)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- AWDSDNDSSSSVLQYAGVLKKLGRGPAKASPQPALTVKAKATSSATTAAAPTLRRLALSSRSGLERKPESLSKVSIIK
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables immunohistochemical mapping of C19orf47 expression in human tissues, supporting exploratory analyses of its cellular distribution and potential involvement in regulatory processes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

