Anti-C1QBP
Overview
The Anti-C1QBP antibody (HPA026483) is a rabbit Triple A Polyclonal reagent targeting human complement component 1, q subcomponent binding protein (C1QBP), a multifunctional protein involved in mitochondrial function, immune signalling, and RNA metabolism. Validated exclusively for Western blot, it enables detection of C1QBP in human lysates.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human C1QBP
- Validated only for Western blot (WB)
- Recombinant antigen fragment containing acidic and glycine-rich motifs
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- C1QBP (complement component 1, q subcomponent binding protein)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of C1QBP, enabling studies of mitochondrial biology, complement-related signalling, and RNA-associated protein complexes in human cells.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

