Anti-C6orf203
Overview
The Anti-C6orf203 antibody (HPA049535) is a rabbit Triple A Polyclonal reagent targeting human C6orf203, a mitochondrial-associated protein of currently limited functional characterisation. The antibody is raised against a recombinant fragment containing acidic, low-complexity, and basic sequence motifs. Validated exclusively for immunohistochemistry, it enables localisation of C6orf203 in fixed human tissue samples.
Highlights
- Rabbit Triple A Polyclonal antibody against human C6orf203
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment with mixed regulatory sequence features
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- C6orf203 (chromosome 6 open reading frame 203)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- VRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYK
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical analysis of C6orf203 expression across human tissues, facilitating exploratory studies of mitochondrial-associated proteins and their cellular distribution.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
