Anti-CAMKK2
Overview
The Anti-CAMKK2 antibody (HPA017389) is a rabbit Triple A Polyclonal reagent recognising human CAMKK2, a serine/threonine kinase involved in Ca2+/calmodulin-dependent signalling. The immunogen corresponds to a recombinant region containing regulatory, acidic, and low-complexity elements. Validated only for Western blot, it enables detection of CAMKK2 in human protein lysates.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human CAMKK2
- Validated only for Western blot (WB)
- Recombinant immunogen fragment representing regulatory domains
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- CAMKK2 (calcium/calmodulin-dependent protein kinase kinase 2, beta)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSS
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables Western blot detection of CAMKK2, supporting studies of kinase-dependent signalling, calcium-mediated pathways, and regulatory mechanisms influencing metabolic and neuronal processes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
