Anti-CARS2
Overview
The Anti-CARS2 antibody (HPA041776) is a rabbit Triple A Polyclonal reagent targeting human CARS2, a mitochondrial cysteinyl-tRNA synthetase required for mitochondrial translation. The immunogen corresponds to a recombinant structured region of CARS2. Validated exclusively for Western blot, this antibody enables detection of CARS2 in human mitochondrial-enriched lysates.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human CARS2
- Validated only for Western blot (WB)
- Recombinant antigen fragment representing catalytic and structural elements
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- CARS2 (cysteinyl-tRNA synthetase 2, mitochondrial)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of CARS2, enabling studies of mitochondrial translation, aminoacyl-tRNA synthetase biology, and energy-related metabolic processes in human cells.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
