Anti-CAV1
Overview
The Anti-CAV1 antibody (HPA049326) is a rabbit Triple A Polyclonal reagent targeting human caveolin-1, a structural component of caveolae involved in membrane trafficking and signalling. The antibody is produced using a recombinant fragment from a conserved region of the protein. Validated exclusively for Western blot, it supports detection of caveolin-1 in human lysates.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human caveolin-1
- Validated only for Western blot (WB)
- Recombinant antigen fragment from a conserved CAV1 domain
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- CAV1 (caveolin 1, caveolae protein, 22 kDa)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of caveolin-1, enabling analysis of membrane-associated signalling, trafficking pathways, and comparative expression profiling in human samples.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
