Anti-CCDC47
Overview
The Anti-CCDC47 antibody (HPA029674) is a rabbit Triple A Polyclonal reagent recognising human CCDC47, an endoplasmic reticulum–associated protein with predicted coiled-coil domains. The antibody is raised against a recombinant fragment containing structural and regulatory motifs. Validated exclusively for immunohistochemistry, it enables localisation of CCDC47 in fixed human tissues.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human CCDC47
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment enriched in coiled-coil domain sequence
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- CCDC47 (coiled-coil domain containing 47)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- YADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRR
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables immunohistochemical detection of CCDC47, supporting studies of ER-associated proteins, structural domains, and cell-type-specific expression patterns across human tissues.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

