Anti-CD226
Overview
The Anti-CD226 antibody (HPA015715) is a rabbit Triple A Polyclonal reagent directed against human CD226, an immunoglobulin superfamily adhesion molecule expressed on subsets of lymphocytes. The immunogen corresponds to an extracellular sequence region containing Ig-like fold elements. Validated exclusively for Western blot, it enables detection of CD226 in human lysates.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human CD226
- Validated only for Western blot (WB)
- Recombinant antigen corresponding to Ig-like extracellular domain
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- CD226 (CD226 molecule)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- DVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTL
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables Western blot detection of CD226, supporting investigations into immune cell activation, adhesion pathways, and lymphocyte receptor expression across human samples.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

