Anti-CD27
Overview
The Anti-CD27 antibody (HPA038936) is a rabbit Triple A Polyclonal reagent directed against human CD27, a TNF receptor superfamily member involved in lymphocyte activation and survival. The antibody is generated using a recombinant extracellular sequence fragment and validated exclusively for immunohistochemistry, allowing localisation of CD27 in fixed tissue samples.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human CD27
- Validated only for immunohistochemistry (IHC)
- Recombinant extracellular immunogen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- CD27 (CD27 molecule)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical detection of CD27, aiding studies of lymphocyte maturation, receptor–ligand interactions, and immune microenvironment characterisation in human tissues.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
