Anti-CD55
Overview
The Anti-CD55 antibody (HPA002190) is a rabbit Triple A Polyclonal reagent targeting human CD55, a complement regulatory protein expressed on many cell types. The antibody is generated using an extracellular immunogen fragment containing folded and glycosylated domain regions. Validated only for immunohistochemistry, it allows mapping of CD55 distribution in human tissues.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human CD55
- Validated exclusively for immunohistochemistry (IHC)
- Recombinant extracellular antigen sequence
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- CD55 (decay accelerating factor for complement, Cromer blood group)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- YCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMG
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical detection of CD55, enabling studies of complement regulation, epithelial and endothelial expression, and immune microenvironment landscapes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
