Anti-CD8A
Overview
The Anti-CD8A antibody (HPA037756) is a rabbit Triple A Polyclonal reagent targeting human CD8A, an essential co-receptor expressed predominantly on cytotoxic T cells. The antibody is raised against a recombinant extracellular sequence fragment. Validated for immunohistochemistry only, it enables localisation of CD8A+ cells within tissue samples.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human CD8A
- Validated exclusively for immunohistochemistry (IHC)
- Recombinant antigen from CD8A extracellular domain
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- CD8A (CD8a molecule)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical mapping of CD8A-positive lymphocytes, aiding studies of cytotoxic immune responses, tumour immune infiltration, and lymphoid tissue organisation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
