Anti-CD96
Overview
The Anti-CD96 antibody (HPA066754) is a rabbit Triple A Polyclonal reagent directed against human CD96, an immunoglobulin superfamily receptor expressed on subsets of T and NK cells. The immunogen corresponds to a recombinant extracellular region. Validated exclusively for immunohistochemistry, the antibody enables localisation of CD96-expressing cells within tissue specimens.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human CD96
- Validated only for immunohistochemistry (IHC)
- Recombinant immunogen covering extracellular binding region
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- CD96 (CD96 molecule)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical detection of CD96, aiding investigations of immune receptor biology, NK and T cell characterisation, and tissue-specific immune landscapes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
