Anti-CDCA2
Overview
The Anti-CDCA2 antibody (HPA030049) is a rabbit Triple A Polyclonal reagent directed against human CDCA2, a chromatin-associated factor implicated in cell cycle progression and protein phosphatase regulation. The immunogen corresponds to a recombinant sequence enriched in regulatory and basic motifs. Validated exclusively for immunocytochemistry, it enables intracellular localisation of CDCA2 in cultured cells.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human CDCA2
- Validated only for immunocytochemistry (ICC)
- Recombinant antigen fragment containing regulatory domains
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- CDCA2 (cell division cycle associated 2)
- Antibody type
- Triple A Polyclonал
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- ICC only
- Immunogen sequence
- IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables ICC-based localisation of CDCA2, supporting studies of chromatin-associated regulators, mitotic signalling, and cell cycle–dependent protein distribution.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
