Anti-CDH3 Antibody
Overview
This antibody targets human cadherin 3 (CDH3), also known as P-cadherin, a calcium-dependent cell–cell adhesion molecule expressed in epithelial tissues. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Recognises human CDH3 (P-cadherin)
- Sequence-defined peptide immunogen
- Validated for Western Blot (WB) or Immunohistochemistry (IHC) depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Cadherin 3, P-cadherin (CDH3)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- YNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPE
- Validated applications
- WB (SKU: HPA001767WB); IHC (SKU: HPA001767IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for detection and localisation of CDH3 in human samples by western blot or immunohistochemistry. Supports studies of epithelial adhesion and tissue organisation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

