Anti-CDK13
Overview
The Anti-CDK13 antibody (HPA059241) is a rabbit Triple A Polyclonal reagent targeting human cyclin-dependent kinase 13, a serine/threonine kinase involved in transcriptional regulation and RNA processing. The antibody is raised against a recombinant protein fragment enriched in regulatory and low-complexity regions. It is validated exclusively for immunocytochemistry applications.
Highlights
- Rabbit Triple A Polyclonal antibody against human CDK13
- Validated only for immunocytochemistry (ICC)
- Recombinant immunogen containing regulatory sequence regions
- Supplied in glycerol-based buffer formulation
At-a-glance
- Antigen
- CDK13 (cyclin-dependent kinase 13)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- ICC only
- Immunogen sequence
- PLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPE
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables immunocytochemical localisation of CDK13 in cultured cells, supporting studies of transcription-associated kinases and nuclear regulatory processes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
