Anti-CDK19
Overview
The Anti-CDK19 antibody (HPA007053) is a rabbit Triple A Polyclonal reagent recognising human cyclin-dependent kinase 19, a component of the mediator kinase module involved in transcriptional regulation. The immunogen consists of a low-complexity, proline- and glutamine-rich region. This antibody is validated exclusively for Western blot applications.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human CDK19
- Validated only for Western blot (WB)
- Recombinant immunogen enriched in regulatory low-complexity regions
- Glycerol-based buffer formulation
At-a-glance
- Antigen
- CDK19 (cyclin-dependent kinase 19)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- Western blot (WB) only
- Immunogen sequence
- KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHPSH
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot analysis of CDK19, facilitating studies of transcriptional control mechanisms and mediator complex-associated kinases.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

