Anti-CDKL5 Antibody
Overview
This antibody recognises human cyclin-dependent kinase-like 5 (CDKL5), a serine/threonine kinase implicated in neuronal development and signalling. It is generated against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunocytochemistry.
Highlights
- Targets human CDKL5 protein
- Sequence-defined peptide immunogen
- Validated for Western Blot (WB) or Immunocytochemistry (ICC) depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Cyclin-dependent kinase-like 5 (CDKL5)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDP
- Validated applications
- WB (SKU: HPA002847WB); ICC (SKU: HPA002847ICC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or cellular localisation of CDKL5 in human samples by western blot or immunocytochemistry. Supports research into kinase signalling and neuronal biology.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
