Anti-CTPS2
Overview
The Anti-CTPS2 antibody (HPA017437) is a rabbit Triple A Polyclonal antibody directed against human CTP synthase 2, a cytosolic enzyme involved in de novo pyrimidine nucleotide biosynthesis. The antibody is raised against a recombinant fragment of the human protein. It is validated exclusively for Western blot applications.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human CTPS2
- Validated for Western blot (WB) only
- Recognises an enzyme involved in nucleotide biosynthesis
- Suitable for analysis of human protein expression
At-a-glance
- Antigen
- CTPS2 (CTP synthase 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated application
- Western blot (WB)
- Immunogen sequence
- GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody is intended for Western blot analysis of CTPS2 in human samples, supporting studies of nucleotide metabolism, cell proliferation, and metabolic regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
