Anti-CTSG
Overview
The Anti-CTSG antibody (HPA047737) is a rabbit Triple A Polyclonal antibody targeting human cathepsin G, a serine protease predominantly expressed in neutrophils and other myeloid cells. The antibody is generated against a recombinant fragment of the human protein. It is validated exclusively for immunohistochemistry applications.
Highlights
- Rabbit Triple A Polyclonal antibody against human CTSG
- Validated for immunohistochemistry (IHC) only
- Targets a neutrophil-associated serine protease
- Suitable for localisation studies in human tissues
At-a-glance
- Antigen
- CTSG (cathepsin G)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated application
- Immunohistochemistry (IHC)
- Immunogen sequence
- GRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFK
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical localisation of cathepsin G, enabling analysis of neutrophil distribution and protease expression in human tissue sections.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
