Anti-CXADR
Overview
The Anti-CXADR antibody (HPA030411) is a rabbit Triple A Polyclonal antibody targeting the human coxsackievirus and adenovirus receptor, a cell surface protein involved in viral entry and cell–cell adhesion. The antibody is raised against a recombinant fragment of the protein and is validated exclusively for immunohistochemistry.
Highlights
- Rabbit Triple A Polyclonal antibody against human CXADR
- Validated for immunohistochemistry (IHC) only
- Targets a viral entry and adhesion receptor
- Suitable for tissue localisation studies
At-a-glance
- Antigen
- CXADR (coxsackie virus and adenovirus receptor)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated application
- IHC only
- Immunogen sequence
- EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody is intended for immunohistochemical detection of CXADR, supporting studies of epithelial integrity, viral receptor expression, and tissue-specific localisation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
