Anti-CYP24A1
Overview
The Anti-CYP24A1 antibody is a rabbit Triple A Polyclonal antibody targeting human cytochrome P450 family 24 subfamily A member 1, an enzyme responsible for the catabolism of active vitamin D metabolites. The antibody is raised against a recombinant protein fragment and is validated exclusively for Western blot applications.
Highlights
- Rabbit Triple A Polyclonal antibody against human CYP24A1
- Validated for Western blot (WB) only
- Targets a vitamin D–metabolising cytochrome P450 enzyme
- Suitable for metabolic pathway studies
At-a-glance
- Antigen
- CYP24A1 (cytochrome P450 family 24 subfamily A member 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated application
- Western blot (WB)
- Immunogen sequence
- DFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQV
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
Suitable for Western blot analysis of CYP24A1 in human samples, supporting studies of vitamin D metabolism and endocrine regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
