Anti-DDAH2
Overview
The Anti-DDAH2 antibody (HPA012509) is a rabbit Triple A Polyclonal antibody targeting human dimethylarginine dimethylaminohydrolase 2, an enzyme involved in nitric oxide regulation through metabolism of methylated arginines. The antibody is raised against a recombinant protein fragment and is validated exclusively for Western blot applications.
Highlights
- Rabbit Triple A Polyclonal antibody against human DDAH2
- Validated for Western blot (WB) only
- Targets an enzyme involved in nitric oxide metabolism
- Suitable for protein expression analysis
At-a-glance
- Antigen
- DDAH2 (dimethylarginine dimethylaminohydrolase 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated application
- Western blot (WB)
- Immunogen sequence
- ESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEI
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody is suitable for Western blot analysis of DDAH2 in human samples, supporting studies of nitric oxide signalling and vascular biology.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

