Anti-DHRSX Antibody
Overview
This antibody recognises human dehydrogenase/reductase X-linked (DHRSX), a member of the short-chain dehydrogenase/reductase (SDR) family involved in cellular redox and metabolic processes. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Targets human DHRSX protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Dehydrogenase/reductase X-linked (DHRSX)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- PRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDK
- Validated applications
- WB (SKU: HPA003035WB); IHC (SKU: HPA003035IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or localisation of DHRSX in human samples by western blot or immunohistochemistry. Supports studies of SDR-family enzymes and cellular metabolism.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
