Anti-FAR1 Antibody
Overview
This antibody targets human fatty acyl-CoA reductase 1 (FAR1), an enzyme involved in lipid metabolism and ether lipid biosynthesis. It is generated against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Recognises human FAR1 protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Fatty acyl-CoA reductase 1 (FAR1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNENLRDAVQLNVIATRQLILLAQQMKNLEVFM
- Validated applications
- WB (SKU: HPA017322WB); IHC (SKU: HPA017322IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for detection or localisation of FAR1 in human samples by western blot or immunohistochemistry. Supports research into lipid metabolism and peroxisomal function.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
